PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3767s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 292aa    MW: 32938.7 Da    PI: 8.6557
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3767s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.35.5e-317314554128
                     NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             +ekewyfF++rd+ky++g+r+nra+ +gyWkatg dk++ +   ++vg+kk Lvfy g+apkgekt+W+mheyrl
  SapurV1A.3767s0010.1.p  73 GEKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKPIGQ--PKTVGIKKALVFYAGKAPKGEKTNWIMHEYRL 145
                             689************************************98..778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100535.94518171IPR003441NAC domain
PfamPF023652.2E-1659145IPR003441NAC domain
SuperFamilySSF1019411.7E-3664171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MRSSCCTISA VNAHRSPLPS LLLLKSISTS LTLGISLVTS CSCFNLLFYQ LITSFFHFCC  60
YLLCQITGMA LYGEKEWYFF TPRDRKYPNG SRPNRAAGRG YWKATGADKP IGQPKTVGIK  120
KALVFYAGKA PKGEKTNWIM HEYRLAEVDR SVRKKNSLRL DDWVLCRIHN KKGTIERQGQ  180
HLSVKKANST EIVEEDEKKS VVMLPPPPAP SSATGTVNDY VYFDTSDSVP RLHTDSSCSE  240
HVVSPEFTCE VQSNPYNYLD ATMDIPFTSQ FQGDYQMSPL QDMFMYLQKP F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-487017764174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2279790.0CU227979.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002307447.11e-163no apical meristem family protein
RefseqXP_011003434.11e-163PREDICTED: NAC domain-containing protein 2-like
SwissprotQ390131e-106NAC2_ARATH; NAC domain-containing protein 2
TrEMBLB9H7H21e-163B9H7H2_POPTR; No apical meristem family protein
STRINGPOPTR_0005s20240.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF125834108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.11e-103NAC family protein